Lineage for d1cjbb_ (1cjb B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25845Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 25846Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 25847Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. Protein Hypoxantine-guanine PRTase (HGPRTase) [53283] (2 species)
  7. Species Plasmodium falciparum [53285] (1 PDB entry)
  8. Domain d1cjbb_: 1cjb B: [34080]

Details for d1cjbb_

PDB Entry: 1cjb (more details), 2 Å

PDB Description: malarial purine phosphoribosyltransferase

SCOP Domain Sequences for d1cjbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjbb_ c.61.1.1 (B:) Hypoxantine-guanine PRTase (HGPRTase) {Plasmodium falciparum}
pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat

SCOP Domain Coordinates for d1cjbb_ are not available.

Timeline for d1cjbb_:

Domains from other chains:
(mouse over for more information)
d1cjba_, d1cjbc_, d1cjbd_