![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5wjoa2: 5wjo A:111-199 [340799] Other proteins in same PDB: d5wjoa1, d5wjob1, d5wjob2, d5wjoc1, d5wjod1, d5wjod2 automated match to d4z7vg2 complexed with cl, edo, na |
PDB Entry: 5wjo (more details), 2.5 Å
SCOPe Domain Sequences for d5wjoa2:
Sequence, based on SEQRES records: (download)
>d5wjoa2 b.1.1.2 (A:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn savawsnksdfacanafnnsiipedtffp
>d5wjoa2 b.1.1.2 (A:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]} niqnpdpavyqlrdskssdksvclftdfdsqtnvsqvyitdkcvldmrsmdfksnsavaw snfacanafnnsiipedtffp
Timeline for d5wjoa2: