Lineage for d5wjoa2 (5wjo A:111-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751735Domain d5wjoa2: 5wjo A:111-199 [340799]
    Other proteins in same PDB: d5wjoa1, d5wjob1, d5wjob2, d5wjoc1, d5wjod1, d5wjod2
    automated match to d4z7vg2
    complexed with cl, edo, na

Details for d5wjoa2

PDB Entry: 5wjo (more details), 2.5 Å

PDB Description: crystal structure of the unliganded pg90 tcr
PDB Compounds: (A:) PG90 TCR alpha chain

SCOPe Domain Sequences for d5wjoa2:

Sequence, based on SEQRES records: (download)

>d5wjoa2 b.1.1.2 (A:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d5wjoa2 b.1.1.2 (A:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqvyitdkcvldmrsmdfksnsavaw
snfacanafnnsiipedtffp

SCOPe Domain Coordinates for d5wjoa2:

Click to download the PDB-style file with coordinates for d5wjoa2.
(The format of our PDB-style files is described here.)

Timeline for d5wjoa2: