| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5wjoa1: 5wjo A:3-110 [340798] Other proteins in same PDB: d5wjoa2, d5wjoc2 automated match to d4z7vg1 complexed with cl, edo, na |
PDB Entry: 5wjo (more details), 2.5 Å
SCOPe Domain Sequences for d5wjoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wjoa1 b.1.1.0 (A:3-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kttqppsmdcaegraanlpcnhstisgneyvywyrqihsqgpqyiihglknnetnemasl
iitedrksstlilphatlrdtavyycivrvayrqkvtfgtgtklqvip
Timeline for d5wjoa1: