Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [53285] (1 PDB entry) |
Domain d1cjba_: 1cjb A: [34079] complexed with irp, mg, pop |
PDB Entry: 1cjb (more details), 2 Å
SCOPe Domain Sequences for d1cjba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat
Timeline for d1cjba_: