Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries) |
Domain d5tnya1: 5tny A:142-343 [340786] Other proteins in same PDB: d5tnya2 automated match to d1lcya2 complexed with mes; mutant |
PDB Entry: 5tny (more details), 1.7 Å
SCOPe Domain Sequences for d5tnya1:
Sequence, based on SEQRES records: (download)
>d5tnya1 b.47.1.1 (A:142-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg spfalqntitsgivssaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigvn tmkvtagisfaipsdrlreflh
>d5tnya1 b.47.1.1 (A:142-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg spfalqntitsgivssaqrpaveyiqtdaaidfgnsggplvnldgevigvntmkvtagis faipsdrlreflh
Timeline for d5tnya1: