SCOPe 2.07: Domain d5xp3e_: 5xp3 E:

Lineage for d5xp3e_ (5xp3 E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)

8. Domain d5xp3e_: 5xp3 E: [340784]
   Other proteins in same PDB: d5xp3a1, d5xp3a2, d5xp3b1, d5xp3b2, d5xp3c1, d5xp3c2, d5xp3d1, d5xp3d2, d5xp3f1, d5xp3f2, d5xp3f3
   automated match to d4i55e_
   complexed with acp, ca, gdp, gol, gtp, mes, mg

Details for d5xp3e_

PDB Entry: 5xp3, 2.3 Å

PDB Description: crystal structure of apo t2r-ttl

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5xp3e_:

Sequence, based on SEQRES records:

>d5xp3e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records):

>d5xp3e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

Timeline for d5xp3e_:

• d5xp3e_ first appeared in SCOPe 2.06
  
• d5xp3e_ appears in the current release, SCOPe 2.08