Lineage for d5wb7g_ (5wb7 G:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2635894Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2636414Protein automated matches [190092] (2 species)
    not a true protein
  7. 2636415Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)
  8. 2636500Domain d5wb7g_: 5wb7 G: [340772]
    automated match to d1k36a_
    complexed with bma, man, nag

Details for d5wb7g_

PDB Entry: 5wb7 (more details), 2.94 Å

PDB Description: crystal structure of the epidermal growth factor receptor extracellular region in complex with epiregulin
PDB Compounds: (G:) Proepiregulin

SCOPe Domain Sequences for d5wb7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wb7g_ g.3.11.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sitkcssdmngyclhgqciylvdmsqnycrcevgytgvrcehffltv

SCOPe Domain Coordinates for d5wb7g_:

Click to download the PDB-style file with coordinates for d5wb7g_.
(The format of our PDB-style files is described here.)

Timeline for d5wb7g_: