SCOPe 2.06: Domain d5myma1: 5mym A:17-94

Lineage for d5myma1 (5mym A:17-94)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Ethr repressor [109651] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (28 PDB entries)
   Uniprot P96222 22-215

8. Domain d5myma1: 5mym A:17-94 [340737]
   Other proteins in same PDB: d5myma2, d5mymb2, d5mymc2, d5mymd2
   automated match to d1t56a1
   complexed with edo, hyv

Details for d5myma1

PDB Entry: 5mym, 2.28 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound gsk2032710a at 2.28a resolution

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5myma1:

Sequence; same for both SEQRES and ATOM records:

>d5myma1 a.4.1.9 (A:17-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
tarpsgddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltll
drvvnqadmalqtlaenp

Timeline for d5myma1:

• d5myma1 is new in SCOPe 2.06-stable
  
• d5myma1 appears in SCOPe 2.07
  
• d5myma1 appears in the current release, SCOPe 2.08