SCOPe 2.06: Domain d1bzya_: 1bzy A:

Lineage for d1bzya_ (1bzy A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries)

8. Domain d1bzya_: 1bzy A: [34071]
   complexed with imu, mg, pop

Details for d1bzya_

PDB Entry: 1bzy, 2 Å

PDB Description: human hgprtase with transition state inhibitor

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1bzya_:

Sequence; same for both SEQRES and ATOM records:

>d1bzya_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

Timeline for d1bzya_:

• d1bzya_ first appeared (with stable ids) in SCOP 1.55
  
• d1bzya_ appears in SCOPe 2.05
  
• d1bzya_ appears in SCOPe 2.07
  
• d1bzya_ appears in the current release, SCOPe 2.08