Lineage for d1bzya_ (1bzy A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25845Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 25846Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 25847Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. Protein Hypoxantine-guanine PRTase (HGPRTase) [53283] (2 species)
  7. 25892Species Human (Homo sapiens) [TaxId:9606] [53284] (3 PDB entries)
  8. 25893Domain d1bzya_: 1bzy A: [34071]

Details for d1bzya_

PDB Entry: 1bzy (more details), 2 Å

PDB Description: human hgprtase with transition state inhibitor

SCOP Domain Sequences for d1bzya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bzya_ c.61.1.1 (A:) Hypoxantine-guanine PRTase (HGPRTase) {Human (Homo sapiens)}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

SCOP Domain Coordinates for d1bzya_:

Click to download the PDB-style file with coordinates for d1bzya_.
(The format of our PDB-style files is described here.)

Timeline for d1bzya_: