Lineage for d1dqpb_ (1dqp B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128309Protein Guanine PRTase [53281] (1 species)
  7. 2128310Species Giardia intestinalis [TaxId:5741] [53282] (2 PDB entries)
  8. 2128314Domain d1dqpb_: 1dqp B: [34070]
    complexed with img, ipa

Details for d1dqpb_

PDB Entry: 1dqp (more details), 1.75 Å

PDB Description: crystal structure of giardia guanine phosphoribosyltransferase complexed with immucilling
PDB Compounds: (B:) guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1dqpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqpb_ c.61.1.1 (B:) Guanine PRTase {Giardia intestinalis [TaxId: 5741]}
micsvtgkpvkdvlstffkdrndvlesevkkfhllatfeeckalaadtarrmneyykdva
epvtlvalltgaylyaslltvhltfpytlhfvkvssykgtrqesvvfdeedlkqlkekre
vvlideyvdsghtifsiqeqikhakicscfvkdvdaikkhsaladtkmfygytpmpkgsw
ligfglddnglrrgwahlfdinlsesevtefrrrltehikglningvnry

SCOPe Domain Coordinates for d1dqpb_:

Click to download the PDB-style file with coordinates for d1dqpb_.
(The format of our PDB-style files is described here.)

Timeline for d1dqpb_: