Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein automated matches [190068] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189507] (94 PDB entries) |
Domain d5x23a_: 5x23 A: [340694] automated match to d2vn0a_ complexed with hem, k, lsn, po4 |
PDB Entry: 5x23 (more details), 2 Å
SCOPe Domain Sequences for d5x23a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x23a_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} klppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkeal idlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqe earclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklneniki lsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcf lmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeei ervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgtti lisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelfl fltsilqnfnlkslvdpknldttpvvngftsvppfyqlcfipi
Timeline for d5x23a_: