SCOPe 2.05: Domain d1dqpa_: 1dqp A:

Lineage for d1dqpa_ (1dqp A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Guanine PRTase [53281] (1 species)

7. Species Giardia intestinalis [TaxId:5741] [53282] (2 PDB entries)

8. Domain d1dqpa_: 1dqp A: [34069]
   complexed with img, ipa

Details for d1dqpa_

PDB Entry: 1dqp, 1.75 Å

PDB Description: crystal structure of giardia guanine phosphoribosyltransferase complexed with immucilling

PDB Compounds: (A:) guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1dqpa_:

Sequence; same for both SEQRES and ATOM records:

>d1dqpa_ c.61.1.1 (A:) Guanine PRTase {Giardia intestinalis [TaxId: 5741]}
micsvtgkpvkdvlstffkdrndvlesevkkfhllatfeeckalaadtarrmneyykdva
epvtlvalltgaylyaslltvhltfpytlhfvkvssykgtrqesvvfdeedlkqlkekre
vvlideyvdsghtifsiqeqikhakicscfvkdvdaikkhsaladtkmfygytpmpkgsw
ligfglddnglrrgwahlfdinlsesevtefrrrltehikglningvnry

Timeline for d1dqpa_:

• d1dqpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqpa_ appears in SCOPe 2.04
  
• d1dqpa_ appears in SCOPe 2.06
  
• d1dqpa_ appears in the current release, SCOPe 2.08