SCOPe 2.07: Domain d5nfzb2: 5nfz B:246-439

Lineage for d5nfzb2 (5nfz B:246-439)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

8. Domain d5nfzb2: 5nfz B:246-439 [340689]
   Other proteins in same PDB: d5nfza1, d5nfzb1, d5nfzc1, d5nfzd1, d5nfze_, d5nfzf1, d5nfzf2, d5nfzf3
   automated match to d3rycd2
   complexed with 8wb, acp, ca, gdp, gol, gtp, mes, mg

Details for d5nfzb2

PDB Entry: 5nfz, 2.1 Å

PDB Description: tubulin-mtc complex

PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5nfzb2:

Sequence, based on SEQRES records:

>d5nfzb2 d.79.2.1 (B:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdat

Sequence, based on observed residues (ATOM records):

>d5nfzb2 d.79.2.1 (B:246-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsqyraltvpeltqqmfdsknmmaacdprh
gryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatf
ignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd
at

Timeline for d5nfzb2:

• d5nfzb2 first appeared in SCOPe 2.06
  
• d5nfzb2 appears in the current release, SCOPe 2.08