Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries) |
Domain d5to0a1: 5to0 A:142-344 [340685] Other proteins in same PDB: d5to0a2, d5to0a3 automated match to d1lcya2 complexed with mes; mutant |
PDB Entry: 5to0 (more details), 1.9 Å
SCOPe Domain Sequences for d5to0a1:
Sequence, based on SEQRES records: (download)
>d5to0a1 b.47.1.1 (A:142-344) automated matches {Human (Homo sapiens) [TaxId: 9606]} sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg spfalqntitsgivcsaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigvn tmkvtagisfaipsdrlreflhr
>d5to0a1 b.47.1.1 (A:142-344) automated matches {Human (Homo sapiens) [TaxId: 9606]} sprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvva drrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvamg spfalqntitsgivcsaqnveyiqtdaaidfgnsggplvnldgevigvntmkvtagisfa ipsdrlreflhr
Timeline for d5to0a1: