Lineage for d5vbzc_ (5vbz C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475032Protein cH-p21 Ras protein [52593] (1 species)
  7. 2475033Species Human (Homo sapiens) [TaxId:9606] [52594] (155 PDB entries)
    Uniprot Q6P716
  8. 2475212Domain d5vbzc_: 5vbz C: [340670]
    automated match to d2q21a_
    complexed with 92v, gnp, mg

Details for d5vbzc_

PDB Entry: 5vbz (more details), 2.2 Å

PDB Description: crystal structure of small molecule disulfide 2c07 bound to h-ras m72c gppnhp
PDB Compounds: (C:) gtpase hras

SCOPe Domain Sequences for d5vbzc_:

Sequence, based on SEQRES records: (download)

>d5vbzc_ c.37.1.8 (C:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqycrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records): (download)

>d5vbzc_ c.37.1.8 (C:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
eysamrdqycrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaa
rtvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

SCOPe Domain Coordinates for d5vbzc_:

Click to download the PDB-style file with coordinates for d5vbzc_.
(The format of our PDB-style files is described here.)

Timeline for d5vbzc_: