![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Guanine PRTase [53281] (1 species) |
![]() | Species Giardia intestinalis [TaxId:5741] [53282] (2 PDB entries) |
![]() | Domain d1dqna_: 1dqn A: [34067] complexed with imu, ipa, mg, pop |
PDB Entry: 1dqn (more details), 1.75 Å
SCOPe Domain Sequences for d1dqna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia intestinalis [TaxId: 5741]} micsvtgkpvkdvlstffkdrndvlesevkkfhllatfeeckalaadtarrmneyykdva epvtlvalltgaylyaslltvhltfpytlhfvkvssykgtrqesvvfdeedlkqlkekre vvlideyvdsghtifsiqeqikhakicscfvkdvdaikkhsaladtkmfygytpmpkgsw ligfglddnglrrgwahlfdinlsesevtefrrrltehikglningvnry
Timeline for d1dqna_: