SCOPe 2.08: Domain d5tmxb1: 5tmx B:7-63

Lineage for d5tmxb1 (5tmx B:7-63)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.34: Dimerisation interlock [47405] (4 superfamilies)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.34.1: SinR repressor dimerisation domain-like [47406] (1 family)
   intertwined heterodimer of two homologous chains

5. Family a.34.1.1: SinR repressor dimerisation domain-like [47407] (3 proteins)

6. Protein automated matches [340630] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [340631] (1 PDB entry)

8. Domain d5tmxb1: 5tmx B:7-63 [340665]
   Other proteins in same PDB: d5tmxa2, d5tmxb2
   automated match to d1b0nb_

Details for d5tmxb1

PDB Entry: 5tmx

PDB Description: solution structure of sini, antagonist to the master biofilm-regulator sinr in bacillus subtilis

PDB Compounds: (B:) Protein SinI

SCOPe Domain Sequences for d5tmxb1:

Sequence; same for both SEQRES and ATOM records:

>d5tmxb1 a.34.1.1 (B:7-63) automated matches {Bacillus subtilis [TaxId: 224308]}
mknakqehfeldqewvelmveakeanispeeirkylllnkksahpgpaarshtvnpf

Timeline for d5tmxb1:

• d5tmxb1 first appeared in SCOPe 2.06
  
• d5tmxb1 appears in SCOPe 2.07