| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.12: TrpR-like [48295] (4 families) ![]() contains an extra shared helix after the HTH motif |
| Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins) intertwined dimer of identical 6-helical subunits automatically mapped to Pfam PF01371 |
| Protein automated matches [254650] (4 species) not a true protein |
| Species Escherichia coli [TaxId:83334] [340663] (7 PDB entries) |
| Domain d5tm0d_: 5tm0 D: [340664] automated match to d1co0a_ |
PDB Entry: 5tm0 (more details)
SCOPe Domain Sequences for d5tm0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tm0d_ a.4.12.1 (D:) automated matches {Escherichia coli [TaxId: 83334]}
maqqspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvrivee
llrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllksd
Timeline for d5tm0d_: