SCOPe 2.07: Domain d1ecbb1: 1ecb B:250-478

Lineage for d1ecbb1 (1ecb B:250-478)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species)

7. Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)

8. Domain d1ecbb1: 1ecb B:250-478 [34064]
   Other proteins in same PDB: d1ecba2, d1ecbb2, d1ecbc2, d1ecbd2
   complexed with 5gp, mg

Details for d1ecbb1

PDB Entry: 1ecb, 2.7 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit

PDB Compounds: (B:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecbb1:

Sequence, based on SEQRES records:

>d1ecbb1 c.61.1.1 (B:250-478) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfl

Sequence, based on observed residues (ATOM records):

>d1ecbb1 c.61.1.1 (B:250-478) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimsvrrklnanraefrdknvllvddsivrgttseq
iiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqiigadglifq
dlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfl

Timeline for d1ecbb1:

• d1ecbb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ecbb1 appears in SCOPe 2.06
  
• d1ecbb1 appears in the current release, SCOPe 2.08