Lineage for d1ecbb1 (1ecb B:250-478)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72728Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 72729Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 72730Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 72737Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)
  7. 72747Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)
  8. 72759Domain d1ecbb1: 1ecb B:250-478 [34064]
    Other proteins in same PDB: d1ecba2, d1ecbb2, d1ecbc2, d1ecbd2

Details for d1ecbb1

PDB Entry: 1ecb (more details), 2.7 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 gmp, 1 mg per subunit

SCOP Domain Sequences for d1ecbb1:

Sequence, based on SEQRES records: (download)

>d1ecbb1 c.61.1.1 (B:250-478) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfl

Sequence, based on observed residues (ATOM records): (download)

>d1ecbb1 c.61.1.1 (B:250-478) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimsvrrklnanraefrdknvllvddsivrgttseq
iiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqiigadglifq
dlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfl

SCOP Domain Coordinates for d1ecbb1:

Click to download the PDB-style file with coordinates for d1ecbb1.
(The format of our PDB-style files is described here.)

Timeline for d1ecbb1: