![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
![]() | Protein automated matches [193506] (4 species) not a true protein |
![]() | Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (52 PDB entries) |
![]() | Domain d5tsfa1: 5tsf A:1-208 [340638] Other proteins in same PDB: d5tsfa2, d5tsfb2, d5tsfc2, d5tsfd2, d5tsfe2 automated match to d2w8gc_ complexed with 7ko, nag |
PDB Entry: 5tsf (more details), 2.29 Å
SCOPe Domain Sequences for d5tsfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tsfa1 b.96.1.0 (A:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerr
Timeline for d5tsfa1: