Lineage for d5nbpa_ (5nbp A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2390364Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries)
  8. 2390367Domain d5nbpa_: 5nbp A: [340634]
    automated match to d3atga_
    complexed with bgc, ca, edo

Details for d5nbpa_

PDB Entry: 5nbp (more details), 1.8 Å

PDB Description: bacteroides ovatus mixed linkage glucan pul (mlgul) gh16 in complex with g4g4g3g product
PDB Compounds: (A:) Glycosyl hydrolase family 16

SCOPe Domain Sequences for d5nbpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nbpa_ b.29.1.0 (A:) automated matches {Bacteroides ovatus [TaxId: 28116]}
ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy
sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg
maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv
kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil

SCOPe Domain Coordinates for d5nbpa_:

Click to download the PDB-style file with coordinates for d5nbpa_.
(The format of our PDB-style files is described here.)

Timeline for d5nbpa_: