Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries) |
Domain d5nbpa_: 5nbp A: [340634] automated match to d3atga_ complexed with bgc, ca, edo |
PDB Entry: 5nbp (more details), 1.8 Å
SCOPe Domain Sequences for d5nbpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nbpa_ b.29.1.0 (A:) automated matches {Bacteroides ovatus [TaxId: 28116]} ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil
Timeline for d5nbpa_: