Lineage for d2r13a1 (2r13 A:33-105)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039055Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
    Fe-S binding region and beta cap
  4. 3039056Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families) (S)
    Pfam PF09360; PubMed 17766440
  5. 3039057Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)
  6. 3039062Protein automated matches [310858] (1 species)
    not a true protein
  7. 3039063Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries)
  8. 3039085Domain d2r13a1: 2r13 A:33-105 [340606]
    Other proteins in same PDB: d2r13a2
    automated match to d3lpqa_
    complexed with cl, fes

Details for d2r13a1

PDB Entry: 2r13 (more details), 1.8 Å

PDB Description: crystal structure of human mitoneet reveals a novel [2fe-2s] cluster coordination
PDB Compounds: (A:) Zinc finger CDGSH domain-containing protein 1

SCOPe Domain Sequences for d2r13a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r13a1 g.97.1.1 (A:33-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkhne
etgdnvgpliikk

SCOPe Domain Coordinates for d2r13a1:

Click to download the PDB-style file with coordinates for d2r13a1.
(The format of our PDB-style files is described here.)

Timeline for d2r13a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r13a2