![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [53280] (5 PDB entries) |
![]() | Domain d1ecjb1: 1ecj B:250-492 [34060] Other proteins in same PDB: d1ecja2, d1ecjb2, d1ecjc2, d1ecjd2 complexed with amp |
PDB Entry: 1ecj (more details), 2.5 Å
SCOPe Domain Sequences for d1ecjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecjb1 c.61.1.1 (B:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav qrq
Timeline for d1ecjb1: