Lineage for d1ecjb1 (1ecj B:250-492)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25845Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 25846Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 25847Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 25854Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)
  7. 25864Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)
  8. 25872Domain d1ecjb1: 1ecj B:250-492 [34060]
    Other proteins in same PDB: d1ecja2, d1ecjb2, d1ecjc2, d1ecjd2

Details for d1ecjb1

PDB Entry: 1ecj (more details), 2.5 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 amp per tetramer

SCOP Domain Sequences for d1ecjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecjb1 c.61.1.1 (B:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrq

SCOP Domain Coordinates for d1ecjb1:

Click to download the PDB-style file with coordinates for d1ecjb1.
(The format of our PDB-style files is described here.)

Timeline for d1ecjb1: