SCOPe 2.08: Domain d5nbpb_: 5nbp B:

Lineage for d5nbpb_ (5nbp B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries)

8. Domain d5nbpb_: 5nbp B: [340593]
   automated match to d3atga_
   complexed with ca, edo

Details for d5nbpb_

PDB Entry: 5nbp, 1.8 Å

PDB Description: bacteroides ovatus mixed linkage glucan pul (mlgul) gh16 in complex with g4g4g3g product

PDB Compounds: (B:) Glycosyl hydrolase family 16

SCOPe Domain Sequences for d5nbpb_:

Sequence; same for both SEQRES and ATOM records:

>d5nbpb_ b.29.1.0 (B:) automated matches {Bacteroides ovatus [TaxId: 28116]}
ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy
sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg
maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv
kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil

Timeline for d5nbpb_:

• d5nbpb_ first appeared in SCOPe 2.06
  
• d5nbpb_ appears in SCOPe 2.07