Lineage for d5nbpb_ (5nbp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780714Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries)
  8. 2780716Domain d5nbpb_: 5nbp B: [340593]
    automated match to d3atga_
    complexed with ca, edo

Details for d5nbpb_

PDB Entry: 5nbp (more details), 1.8 Å

PDB Description: bacteroides ovatus mixed linkage glucan pul (mlgul) gh16 in complex with g4g4g3g product
PDB Compounds: (B:) Glycosyl hydrolase family 16

SCOPe Domain Sequences for d5nbpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nbpb_ b.29.1.0 (B:) automated matches {Bacteroides ovatus [TaxId: 28116]}
ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy
sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg
maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv
kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil

SCOPe Domain Coordinates for d5nbpb_:

Click to download the PDB-style file with coordinates for d5nbpb_.
(The format of our PDB-style files is described here.)

Timeline for d5nbpb_: