SCOPe 2.07: Domain d5nfze_: 5nfz E:

Lineage for d5nfze_ (5nfz E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)

8. Domain d5nfze_: 5nfz E: [340587]
   Other proteins in same PDB: d5nfza1, d5nfza2, d5nfzb1, d5nfzb2, d5nfzc1, d5nfzc2, d5nfzd1, d5nfzd2, d5nfzf1, d5nfzf2, d5nfzf3
   automated match to d4i55e_
   complexed with 8wb, acp, ca, gdp, gol, gtp, mes, mg

Details for d5nfze_

PDB Entry: 5nfz, 2.1 Å

PDB Description: tubulin-mtc complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5nfze_:

Sequence, based on SEQRES records:

>d5nfze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeeas

Sequence, based on observed residues (ATOM records):

>d5nfze_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsrdpsleeiqkkleaaeerrkyqeaellkhlaekrehe
reviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkel
keeas

Timeline for d5nfze_:

• d5nfze_ first appeared in SCOPe 2.06
  
• d5nfze_ appears in the current release, SCOPe 2.08