Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cell cycle checkpoint kinase chk1 [64404] (1 species) CaMK group; CAMKL subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [64405] (100 PDB entries) |
Domain d5oora_: 5oor A: [340581] automated match to d2ydia_ complexed with cl, stu; mutant |
PDB Entry: 5oor (more details), 1.9 Å
SCOPe Domain Sequences for d5oora_:
Sequence, based on SEQRES records: (download)
>d5oora_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicilkml nhenvikfyghrregniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvylh gigithrdikphnlllderdnlkiadyslatvfrynnrerllnkmcgtlpyvapellkrr efhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplall hkilvenpsaritipdikkdrwynkplkkgakrprvtsggv
>d5oora_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} vpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmnikkeicilkmlnhenvikf yghrregniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvylhgigithrd ikphnlllderdnlkiadyslatvfrynnrerllnkmcgtlpyvapellkrrefhaepvd vwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenp saritipdikkdrwynkplkkgakrprvtsggv
Timeline for d5oora_: