![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [53280] (5 PDB entries) |
![]() | Domain d1eccb1: 1ecc B:250-492 [34058] Other proteins in same PDB: d1ecca2, d1eccb2 complexed with mn, onl, pcp |
PDB Entry: 1ecc (more details), 2.4 Å
SCOPe Domain Sequences for d1eccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eccb1 c.61.1.1 (B:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav qrq
Timeline for d1eccb1: