SCOPe 2.08: Domain d5o84a1: 5o84 A:3-83

Lineage for d5o84a1 (5o84 A:3-83)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)

8. Domain d5o84a1: 5o84 A:3-83 [340579]
   Other proteins in same PDB: d5o84a2
   automated match to d4chsa1
   complexed with act, edo, fmt, gol, mg

Details for d5o84a1

PDB Entry: 5o84, 1.88 Å

PDB Description: glutathione s-transferase tau 23 (partially oxidized)

PDB Compounds: (A:) Glutathione S-transferase U23

SCOPe Domain Sequences for d5o84a1:

Sequence; same for both SEQRES and ATOM records:

>d5o84a1 c.47.1.0 (A:3-83) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeiilldywasmygmrtrialeekkvkyeyreedlsnksplllqmnpihkkipvlihegk
picesiiqvqyidelwpdtnp

Timeline for d5o84a1:

• d5o84a1 first appeared in SCOPe 2.06
  
• d5o84a1 appears in SCOPe 2.07