Lineage for d5nzcb_ (5nzc B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970082Protein automated matches [190412] (11 species)
    not a true protein
  7. 2970088Species Betula pendula [TaxId:3505] [340503] (2 PDB entries)
  8. 2970091Domain d5nzcb_: 5nzc B: [340574]
    automated match to d1cqaa_

Details for d5nzcb_

PDB Entry: 5nzc (more details), 2 Å

PDB Description: a disulfide switch determines proteolytic resistance in the birch pollen allergen bet v 2
PDB Compounds: (B:) profilin-2

SCOPe Domain Sequences for d5nzcb_:

Sequence, based on SEQRES records: (download)

>d5nzcb_ d.110.1.1 (B:) automated matches {Betula pendula [TaxId: 3505]}
swqtyvdehlmcdidgqgqqlaasaivghdgsvwaqsssfpqfkpqeitgimkdfeepgh
laptglhlggikymviqgeagavirgkkgsggitikktgqalvfgiyeepvtpgqcnmvv
erlgdylidqgl

Sequence, based on observed residues (ATOM records): (download)

>d5nzcb_ d.110.1.1 (B:) automated matches {Betula pendula [TaxId: 3505]}
swqtyvdehlmlaasaivghdgsvwaqsssfpqfkpqeitgimkdfeepghlaptglhlg
gikymviqgeagavirgkkgsggitikktgqalvfgiyeepvtpgqcnmvverlgdylid
qgl

SCOPe Domain Coordinates for d5nzcb_:

Click to download the PDB-style file with coordinates for d5nzcb_.
(The format of our PDB-style files is described here.)

Timeline for d5nzcb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nzca_