SCOPe 2.06: Domain d1ecgb1: 1ecg B:250-500

Lineage for d1ecgb1 (1ecg B:250-500)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)

7. Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)

8. Domain d1ecgb1: 1ecg B:250-500 [34056]
   Other proteins in same PDB: d1ecga2, d1ecgb2
   complexed with onl, pin

Details for d1ecgb1

PDB Entry: 1ecg, 2.3 Å

PDB Description: don inactivated escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase

PDB Compounds: (B:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecgb1:

Sequence; same for both SEQRES and ATOM records:

>d1ecgb1 c.61.1.1 (B:250-500) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrqnevenlem

Timeline for d1ecgb1:

• d1ecgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ecgb1 appears in SCOPe 2.05
  
• d1ecgb1 appears in SCOPe 2.07
  
• d1ecgb1 appears in the current release, SCOPe 2.08