Lineage for d5xfib_ (5xfi B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. Protein Calystegia sepium agglutinin [101948] (1 species)
  7. Species Hedge bindweed (Calystegia sepium) [TaxId:47519] [101949] (3 PDB entries)
  8. Domain d5xfib_: 5xfi B: [340557]
    automated match to d1ouwb_
    complexed with bez, edo, so4

Details for d5xfib_

PDB Entry: 5xfi (more details), 1.6500000000000001 Å

PDB Description: crystal structure of calsepa lectin in complex with biantennary n- glycan
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d5xfib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xfib_ b.77.3.1 (B:) Calystegia sepium agglutinin {Hedge bindweed (Calystegia sepium) [TaxId: 47519]}
avpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitv
ggggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtp
fssanvvgneivgflgrsgyyvdaigtynrhk

SCOPe Domain Coordinates for d5xfib_ are not available.

Timeline for d5xfib_:

Domains from other chains:
(mouse over for more information)
d5xfia_