Lineage for d5nbob_ (5nbo B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780714Species Bacteroides ovatus [TaxId:28116] [321066] (5 PDB entries)
  8. 2780720Domain d5nbob_: 5nbo B: [340551]
    automated match to d3atga_
    complexed with edo

Details for d5nbob_

PDB Entry: 5nbo (more details), 1.8 Å

PDB Description: bacteroides ovatus mixed linkage glucan pul (mlgul) gh16
PDB Compounds: (B:) Glycosyl hydrolase family 16

SCOPe Domain Sequences for d5nbob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nbob_ b.29.1.0 (B:) automated matches {Bacteroides ovatus [TaxId: 28116]}
ilfkddfnffdekvwtkethepgwtnqelqaydaahvsvgkdgdksvliltaerkgnkiy
sgrinskgkksfkyrkieasiklpktngglwpafwmmgdndkqwpacgeidimemgeqsg
maagdsekqvntaihygpsaaaheqqyykanvanslqdgnyhtysldwdennltisidnv
kfhtfdissntyfhdnfyilfnlavggaftgitdinkltglkdgqkvnmyidwvkil

SCOPe Domain Coordinates for d5nbob_:

Click to download the PDB-style file with coordinates for d5nbob_.
(The format of our PDB-style files is described here.)

Timeline for d5nbob_: