Lineage for d1ecfb1 (1ecf B:250-500)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863466Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 1863493Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)
  7. 1863503Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)
  8. 1863505Domain d1ecfb1: 1ecf B:250-500 [34054]
    Other proteins in same PDB: d1ecfa2, d1ecfb2
    complexed with pin

Details for d1ecfb1

PDB Entry: 1ecf (more details), 2 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase
PDB Compounds: (B:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecfb1 c.61.1.1 (B:250-500) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrqnevenlem

SCOPe Domain Coordinates for d1ecfb1:

Click to download the PDB-style file with coordinates for d1ecfb1.
(The format of our PDB-style files is described here.)

Timeline for d1ecfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ecfb2