![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
![]() | Domain d5ng1c2: 5ng1 C:246-440 [340538] Other proteins in same PDB: d5ng1a1, d5ng1b1, d5ng1c1, d5ng1d1, d5ng1e_, d5ng1f1, d5ng1f2, d5ng1f3 automated match to d4i50a2 complexed with 8wb, 8we, acp, ca, gdp, gol, gtp, mes, mg, zpn |
PDB Entry: 5ng1 (more details), 2.2 Å
SCOPe Domain Sequences for d5ng1c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ng1c2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5ng1c2: