Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries) |
Domain d5m3oa2: 5m3o A:358-458 [340530] Other proteins in same PDB: d5m3oa1, d5m3oa3 automated match to d1lcya1 complexed with mes; mutant |
PDB Entry: 5m3o (more details), 1.7 Å
SCOPe Domain Sequences for d5m3oa2:
Sequence, based on SEQRES records: (download)
>d5m3oa2 b.36.1.0 (A:358-458) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaig eqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte
>d5m3oa2 b.36.1.0 (A:358-458) automated matches {Human (Homo sapiens) [TaxId: 9606]} qrryigvmmltlspsilaelqlrqhgvlihkvilgspahraglrpgdvilaigeqmvqna edvyeavrtqsqlavqitltlyvtpevte
Timeline for d5m3oa2: