Lineage for d5m3oa2 (5m3o A:358-458)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396113Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2396114Protein automated matches [190436] (9 species)
    not a true protein
  7. 2396128Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)
  8. 2396225Domain d5m3oa2: 5m3o A:358-458 [340530]
    Other proteins in same PDB: d5m3oa1, d5m3oa3
    automated match to d1lcya1
    complexed with mes; mutant

Details for d5m3oa2

PDB Entry: 5m3o (more details), 1.7 Å

PDB Description: htra2 a141s mutant structure
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5m3oa2:

Sequence, based on SEQRES records: (download)

>d5m3oa2 b.36.1.0 (A:358-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrryigvmmltlspsilaelqlrepsfpdvqhgvlihkvilgspahraglrpgdvilaig
eqmvqnaedvyeavrtqsqlavqirrgretltlyvtpevte

Sequence, based on observed residues (ATOM records): (download)

>d5m3oa2 b.36.1.0 (A:358-458) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrryigvmmltlspsilaelqlrqhgvlihkvilgspahraglrpgdvilaigeqmvqna
edvyeavrtqsqlavqitltlyvtpevte

SCOPe Domain Coordinates for d5m3oa2:

Click to download the PDB-style file with coordinates for d5m3oa2.
(The format of our PDB-style files is described here.)

Timeline for d5m3oa2: