SCOPe 2.05: Domain d1ecfa1: 1ecf A:250-492

Lineage for d1ecfa1 (1ecf A:250-492)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)

7. Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)

8. Domain d1ecfa1: 1ecf A:250-492 [34053]
   Other proteins in same PDB: d1ecfa2, d1ecfb2
   complexed with pin

Details for d1ecfa1

PDB Entry: 1ecf, 2 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase

PDB Compounds: (A:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecfa1:

Sequence; same for both SEQRES and ATOM records:

>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrq

Timeline for d1ecfa1:

• d1ecfa1 first appeared (with stable ids) in SCOP 1.55
  
• d1ecfa1 appears in SCOPe 2.04
  
• d1ecfa1 appears in SCOPe 2.06
  
• d1ecfa1 appears in the current release, SCOPe 2.08