SCOPe 2.07: Domain d5okrb_: 5okr B:

Lineage for d5okrb_ (5okr B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [319127] (16 PDB entries)

8. Domain d5okrb_: 5okr B: [340528]
   automated match to d1pbga_
   complexed with bg6, gol, imd

Details for d5okrb_

PDB Entry: 5okr, 2.15 Å

PDB Description: conservatively refined structure of gan1d-wt, a putative 6-phospho- beta-galactosidase from geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose

PDB Compounds: (B:) Putative 6-phospho-beta-galactobiosidase

SCOPe Domain Sequences for d5okrb_:

Sequence; same for both SEQRES and ATOM records:

>d5okrb_ c.1.8.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael

Timeline for d5okrb_:

• d5okrb_ first appeared in SCOPe 2.06
  
• d5okrb_ appears in the current release, SCOPe 2.08