Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [319127] (16 PDB entries) |
Domain d5okrb_: 5okr B: [340528] automated match to d1pbga_ complexed with bg6, gol, imd |
PDB Entry: 5okr (more details), 2.15 Å
SCOPe Domain Sequences for d5okrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okrb_ c.1.8.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
Timeline for d5okrb_: