Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311385] (176 PDB entries) |
Domain d5nfzf2: 5nfz F:77-378 [340506] Other proteins in same PDB: d5nfza1, d5nfza2, d5nfzb1, d5nfzb2, d5nfzc1, d5nfzc2, d5nfzd1, d5nfzd2, d5nfze_, d5nfzf1, d5nfzf3 automated match to d3tiia2 complexed with 8wb, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 5nfz (more details), 2.1 Å
SCOPe Domain Sequences for d5nfzf2:
Sequence, based on SEQRES records: (download)
>d5nfzf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d5nfzf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviypderevflaaynrrregregnvwiakssagakgeg ilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyreg vlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttl ensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapaca qklyaelcqgivdvaissvfplatsifikl
Timeline for d5nfzf2: