Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
Family d.58.56.0: automated matches [195116] (1 protein) not a true family |
Protein automated matches [195117] (13 species) not a true protein |
Species Desulfitobacterium hafniense [TaxId:272564] [340495] (1 PDB entry) |
Domain d3nwga1: 3nwg A:1-93 [340496] Other proteins in same PDB: d3nwga3 automated match to d3n79a1 complexed with gol |
PDB Entry: 3nwg (more details), 2.7 Å
SCOPe Domain Sequences for d3nwga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nwga1 d.58.56.0 (A:1-93) automated matches {Desulfitobacterium hafniense [TaxId: 272564]} mesiglvevnsiargieaadamlkaaqvdlleakpvcpgkyivlicgdvaavqssvtagk tmaahsvlddfilpnvhpqvltaisaatpltli
Timeline for d3nwga1: