| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
| Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
| Protein automated matches [191037] (12 species) not a true protein |
| Species Saccharomyces cerevisiae [TaxId:4932] [340488] (1 PDB entry) |
| Domain d5lypa1: 5lyp A:93-228 [340489] Other proteins in same PDB: d5lypa2 automated match to d2buga1 complexed with bo4 |
PDB Entry: 5lyp (more details), 1.55 Å
SCOPe Domain Sequences for d5lypa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lypa1 a.118.8.0 (A:93-228) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
eddaetkakaedlkmqgnkamankdyelainkyteaikvlptnaiyyanraaahsslkey
dqavkdaesaisidpsyfrgysrlgfakyaqgkpeealeaykkvldiegdnateamkrdy
esakkkveqslnlekt
Timeline for d5lypa1: