SCOPe 2.08: Domain d5kwhb_: 5kwh B:

Lineage for d5kwhb_ (5kwh B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Protein kinase CK2, alpha subunit [56142] (3 species)
   CMGC group; CK2 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [75559] (184 PDB entries)

8. Domain d5kwhb_: 5kwh B: [340486]
   automated match to d3h30a_
   complexed with 6xt, edo, so4

Details for d5kwhb_

PDB Entry: 5kwh, 2.12 Å

PDB Description: crystal structure of ck2

PDB Compounds: (B:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d5kwhb_:

Sequence; same for both SEQRES and ATOM records:

>d5kwhb_ d.144.1.7 (B:) Protein kinase CK2, alpha subunit {Human (Homo sapiens) [TaxId: 9606]}
sgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitn
nekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdf
kqlyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaef
yhpgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydq
lvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfl
dkllrydhqsrltareamehpyfytvvkdqa

Timeline for d5kwhb_:

• d5kwhb_ first appeared in SCOPe 2.06
  
• d5kwhb_ appears in SCOPe 2.07