SCOPe 2.06: Domain d5lw4a_: 5lw4 A:

Lineage for d5lw4a_ (5lw4 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [340462] (1 PDB entry)

8. Domain d5lw4a_: 5lw4 A: [340463]
   automated match to d2yoya_

Details for d5lw4a_

PDB Entry: 5lw4

PDB Description: nmr solution structure of the apo-form of the chitin-active lytic polysaccharide monooxygenase bllpmo10a

PDB Compounds: (A:) Putative chitin binding protein

SCOPe Domain Sequences for d5lw4a_:

Sequence; same for both SEQRES and ATOM records:

>d5lw4a_ b.1.18.0 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
hgfiekpgsraalcseafgflnlncgsvmyepqsleakkgfphsgpadgqiasagglfgg
ildqqsenrwfkhimtggehtftwtytaphntsqwhyyitkkgwdpdkplkradfeliga
vphdgspasrnlshhiyipedrlgyhvilavwdvadtenafyqvidvdlvnk

Timeline for d5lw4a_:

• d5lw4a_ is new in SCOPe 2.06-stable
  
• d5lw4a_ appears in SCOPe 2.07
  
• d5lw4a_ appears in the current release, SCOPe 2.08