| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Bacillus licheniformis [TaxId:1402] [340462] (1 PDB entry) |
| Domain d5lw4a_: 5lw4 A: [340463] automated match to d2yoya_ |
PDB Entry: 5lw4 (more details)
SCOPe Domain Sequences for d5lw4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lw4a_ b.1.18.0 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
hgfiekpgsraalcseafgflnlncgsvmyepqsleakkgfphsgpadgqiasagglfgg
ildqqsenrwfkhimtggehtftwtytaphntsqwhyyitkkgwdpdkplkradfeliga
vphdgspasrnlshhiyipedrlgyhvilavwdvadtenafyqvidvdlvnk
Timeline for d5lw4a_: