Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacillus thuringiensis [TaxId:1428] [340430] (3 PDB entries) |
Domain d5gwsd_: 5gws D: [340437] automated match to d4dqxb_ complexed with nad, sin |
PDB Entry: 5gws (more details), 2.35 Å
SCOPe Domain Sequences for d5gwsd_:
Sequence, based on SEQRES records: (download)
>d5gwsd_ c.2.1.0 (D:) automated matches {Bacillus thuringiensis [TaxId: 1428]} iimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsnseaih nlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwce skikgcivniasvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvirt elteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidggwtag
>d5gwsd_ c.2.1.0 (D:) automated matches {Bacillus thuringiensis [TaxId: 1428]} iimisgansgighacikyfleksfhvialdinnnnlkvvqidlsnseaihnlftqldlek lspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwceskikgcivni asvsglmaeperaayvaskhaligltkqmamefgkqnirvnsispgvisnqsldtwglpq divscieylisdqarfitgsnfvidggwtag
Timeline for d5gwsd_: