Lineage for d5gwtd_ (5gwt D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846135Species Bacillus thuringiensis [TaxId:1428] [340430] (3 PDB entries)
  8. 2846139Domain d5gwtd_: 5gwt D: [340434]
    automated match to d4dqxb_
    complexed with nad, sin; mutant

Details for d5gwtd_

PDB Entry: 5gwt (more details), 1.9 Å

PDB Description: 4-hydroxyisoleucine dehydrogenase mutant complexed with nadh and succinate
PDB Compounds: (D:) 4-hydroxyisolecuine dehydrogenase

SCOPe Domain Sequences for d5gwtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gwtd_ c.2.1.0 (D:) automated matches {Bacillus thuringiensis [TaxId: 1428]}
kiimisgansgighacikyfleksfhvialdinnnnlidymktdmplkvvqidlsnseai
hnlftqldleklspdilinaagireitpvlhlsddmfkkvidvnlvapfilsrevakrwc
eskikgcivniasvsglmakperaayvaskhaligltkqmamefgkqnirvnsispgvir
telteeyfsnkalmsmiksnqsldtwglpqdivscieylisdqarfitgsnfvidggqta
gkn

SCOPe Domain Coordinates for d5gwtd_:

Click to download the PDB-style file with coordinates for d5gwtd_.
(The format of our PDB-style files is described here.)

Timeline for d5gwtd_: