Lineage for d1dbrc_ (1dbr C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128418Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)
  7. 2128422Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries)
  8. 2128437Domain d1dbrc_: 1dbr C: [34043]
    complexed with mg

Details for d1dbrc_

PDB Entry: 1dbr (more details), 2.4 Å

PDB Description: hypoxanthine guanine xanthine
PDB Compounds: (C:) hypoxanthine guanine xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1dbrc_:

Sequence, based on SEQRES records: (download)

>d1dbrc_ c.61.1.1 (C:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
iedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklaydihr
tyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqndnstg
qltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsns
lkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv

Sequence, based on observed residues (ATOM records): (download)

>d1dbrc_ c.61.1.1 (C:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
iedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklaydihr
tyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlltvlsddlsi
frdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsnslkgdfvgfsie
dvwivgccydfnemfrdfdhvavlsdaarkkfekv

SCOPe Domain Coordinates for d1dbrc_:

Click to download the PDB-style file with coordinates for d1dbrc_.
(The format of our PDB-style files is described here.)

Timeline for d1dbrc_: