Lineage for d1dbrc_ (1dbr C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)
  7. Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries)
  8. Domain d1dbrc_: 1dbr C: [34043]
    complexed with mg

Details for d1dbrc_

PDB Entry: 1dbr (more details), 2.4 Å

PDB Description: hypoxanthine guanine xanthine
PDB Compounds: (C:) hypoxanthine guanine xanthine phosphoribosyltransferase

SCOPe Domain Sequences for d1dbrc_:

Sequence, based on SEQRES records: (download)

>d1dbrc_ c.61.1.1 (C:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
iedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklaydihr
tyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqndnstg
qltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsns
lkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv

Sequence, based on observed residues (ATOM records): (download)

>d1dbrc_ c.61.1.1 (C:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
iedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklaydihr
tyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlltvlsddlsi
frdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsnslkgdfvgfsie
dvwivgccydfnemfrdfdhvavlsdaarkkfekv

SCOPe Domain Coordinates for d1dbrc_ are not available.

Timeline for d1dbrc_:

Domains from other chains:
(mouse over for more information)
d1dbra_, d1dbrb_, d1dbrd_