SCOPe 2.06: Domain d6b6mb2: 6b6m B:87-156

Lineage for d6b6mb2 (6b6m B:87-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.72: Cyanase C-terminal domain [55233] (1 superfamily)
   intertwined dimer of alpha-beta(2) motifs ; 2 layers, alpha/beta

4. Superfamily d.72.1: Cyanase C-terminal domain [55234] (2 families)
   automatically mapped to Pfam PF02560

5. Family d.72.1.0: automated matches [271343] (1 protein)
   not a true family

6. Protein automated matches [271344] (1 species)
   not a true protein

7. Species Serratia proteamaculans [TaxId:399741] [271345] (2 PDB entries)

8. Domain d6b6mb2: 6b6m B:87-156 [340411]
   Other proteins in same PDB: d6b6ma1, d6b6mb1, d6b6mc1, d6b6md1, d6b6me1
   automated match to d4y42a2

Details for d6b6mb2

PDB Entry: 6b6m, 1.91 Å

PDB Description: cyanase from serratia proteamaculans

PDB Compounds: (B:) cyanate hydratase

SCOPe Domain Sequences for d6b6mb2:

Sequence; same for both SEQRES and ATOM records:

>d6b6mb2 d.72.1.0 (B:87-156) automated matches {Serratia proteamaculans [TaxId: 399741]}
gvptdptiyrfyemvqiygstlkalvheqfgdgiisainfkldikkvpdpdggeravitl
dgkylptkpf

Timeline for d6b6mb2:

• d6b6mb2 is new in SCOPe 2.06-stable
  
• d6b6mb2 appears in SCOPe 2.07
  
• d6b6mb2 appears in the current release, SCOPe 2.08